PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10016816m
Common NameEUTSA_v10016816mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family SBP
Protein Properties Length: 373aa    MW: 40485.6 Da    PI: 8.1622
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10016816mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP137.25e-4372149178
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      +CqvegC +dl++ak y++rh+vC +hsk+p+v+v+gleqrfCqqCsrfh+l efD ekrsCrrrLa+hnerrrk+q+
  Thhalv10016816m  72 RCQVEGCGMDLTNAKGYYSRHRVCGIHSKTPKVIVAGLEQRFCQQCSRFHQLPEFDLEKRSCRRRLAGHNERRRKPQP 149
                      6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.0E-3465134IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.94970147IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.24E-4071151IPR004333Transcription factor, SBP-box
PfamPF031105.1E-3273146IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048653Biological Processanther development
GO:2000025Biological Processregulation of leaf formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MEMGSNSGLG LGPGQAESGG SSTESSSFSG GLMFGQKIYF EDAGGGSGSS SYGGTNRRVR  60
GGGSGQTGQI PRCQVEGCGM DLTNAKGYYS RHRVCGIHSK TPKVIVAGLE QRFCQQCSRF  120
HQLPEFDLEK RSCRRRLAGH NERRRKPQPA SLSVLSSRYG RITPSLYGNA ESGMNGSFLG  180
NQEMGWTSGR TLDTRVMRRP VSAPSWQINP MNVFSQGSVG GGGTSFSSPE TMDTKLESYK  240
GIGDSNCALS LLSNPHQPQD NNSNNNNSTW RTSSGFGPMT VTMAQPPPAP SQHQYLNPPW  300
VFKDEDNTCP NEMSPVLNLG RFTEPDNCQI SGGTTMGEFE LSDHHHQSRR QYMEAENTRA  360
YDPSSHHTNW SL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A9e-3062146184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00307DAPTransfer from AT2G42200Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3535380.0AK353538.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-50-J24.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006411480.10.0hypothetical protein EUTSA_v10016816mg
SwissprotQ700W20.0SPL9_ARATH; Squamosa promoter-binding-like protein 9
TrEMBLE4MYE10.0E4MYE1_EUTHA; mRNA, clone: RTFL01-50-J24
TrEMBLV4MJX00.0V4MJX0_EUTSA; Uncharacterized protein
STRINGscaffold_403069.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21442775
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.10.0squamosa promoter binding protein-like 9